SKIL Antibody - middle region : FITC

SKIL Antibody - middle region : FITC
SKU
AVIARP58074_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: SKIL belongs to the SKI family and may have regulatory role in cell division or differentiation in response to extracellular signals.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SKIL

Molecular Weight: 70kDa

Peptide Sequence: Synthetic peptide located within the following region: LQNEHAQRMEEFYVEQKDLEKKLEQIMKQKCTCDSNLEKDKEAEYAGQLA

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Ski-like protein

Protein Size: 638

Purification: Affinity Purified
More Information
SKU AVIARP58074_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP58074_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 6498
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×