SLC18A1 Antibody - N-terminal region : Biotin

SLC18A1 Antibody - N-terminal region : Biotin
SKU
AVIARP58078_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: The vesicular monoamine transporter acts to accumulate cytosolic monoamines into vesicles, using the proton gradient maintained across the vesicular membrane. Its proper function is essential to the correct activity of the monoaminergic systems that have been implicated in several human neuropsychiatric disorders. The transporter is a site of action of important drugs, including reserpine and tetrabenazine.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human SLC18A1

Molecular Weight: 42kDa

Peptide Sequence: Synthetic peptide located within the following region: FKEVNSSLHLGHAGSSPHALASPAFSTIFSFFNNNTVAVEESVPSGIAWM

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Chromaffin granule amine transporter Ensembl ENSP00000428001

Protein Size: 385

Purification: Affinity Purified
More Information
SKU AVIARP58078_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP58078_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Pig (Porcine), Dog (Canine), Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 6570
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×