Slc25a31 Antibody - middle region : Biotin

Conjugation: Biotin

Description of Target: Slc25a31 catalyzes the exchange of ADP and ATP across the mitochondrial inner membrane. It may serve to mediate energy generating and energy consuming processes in the distal flagellum, possibly as a nucleotide shuttle between flagellar glycolysis, protein phosphorylation and mechanisms of motility.

Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse

Molecular Weight: 35kDa

Peptide Sequence: Synthetic peptide located within the following region: ARTRLGVDIGKGPEQRQFTGLGDCIMKIAKSDGLIGLYQGFGVSVQGIIV

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: ADP/ATP translocase 4

Protein Size: 320

Purification: Affinity Purified

• SKU: AVIARP53806_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP53806_P050-Biotin
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 73333
• Host: Rabbit
• Conjugate: Conjugated, Biotin