SMARCD1 Antibody - middle region : FITC

SMARCD1 Antibody - middle region : FITC
SKU
AVIARP58324_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: SMARCD1 is a member of the SWI/SNF family of proteins, whose members display helicase and ATPase activities and which are thought to regulate transcription of certain genes by altering the chromatin structure around those genes. It is part of the large ATP-dependent chromatin remodeling complex SNF/SWI and has sequence similarity to the yeast Swp73 protein.The protein encoded by this gene is a member of the SWI/SNF family of proteins, whose members display helicase and ATPase activities and which are thought to regulate transcription of certain genes by altering the chromatin structure around those genes. The encoded protein is part of the large ATP-dependent chromatin remodeling complex SNF/SWI and has sequence similarity to the yeast Swp73 protein. Two transcript variants encoding different isoforms have been found for this gene.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SMARCD1

Key Reference: Assmann,E.M., (2006) J. Biol. Chem. 281 (15), 9869-9881

Molecular Weight: 58kDa

Peptide Sequence: Synthetic peptide located within the following region: RKLRIFISNTFNPAKSDAEDGEGTVASWELRVEGRLLEDSALSKYDATKQ

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 1

Protein Size: 515

Purification: Affinity Purified
More Information
SKU AVIARP58324_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP58324_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 6602
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×