SNAPC5 Antibody - N-terminal region : HRP

SNAPC5 Antibody - N-terminal region : HRP
SKU
AVIARP57932_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: SNAPC5 is the part of the SNAPc complex required for the transcription of both RNA polymerase II and III small-nuclear RNA genes. SNAPC5 binds to the proximal sequence element (PSE), a non-TATA-box basal promoter element common to these 2 types of genes. Recruits TBP and BRF2 to the U6 snRNA TATA box.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SNAPC5

Molecular Weight: 11kDa

Peptide Sequence: Synthetic peptide located within the following region: KEEETLLRLKAALHDQLNRLKVEELALQSMISSRRGDEMLSSHTVPEQSH

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: snRNA-activating protein complex subunit 5

Protein Size: 98

Purification: Affinity Purified

Subunit: 5
More Information
SKU AVIARP57932_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57932_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 10302
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×