SNX7 Antibody - middle region : Biotin

SNX7 Antibody - middle region : Biotin
SKU
AVIARP56795_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: This gene encodes a member of the sorting nexin family. Members of this family contain a phox (PX) domain, which is a phosphoinositide binding domain, and are involved in intracellular trafficking. This protein does not contain a coiled coil region like s

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SNX7

Key Reference: Dateki,M., (2005) J. Biol. Chem. 280 (21), 20503-20508

Molecular Weight: 45kDa

Peptide Sequence: Synthetic peptide located within the following region: LDSKVEVLTYKKADTDLLPEEIGKLEDKVECANNALKADWERWKQNMQND

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Sorting nexin-7

Protein Size: 387

Purification: Affinity Purified
More Information
SKU AVIARP56795_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56795_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 51375
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×