SOHLH1 Antibody - C-terminal region : HRP

SOHLH1 Antibody - C-terminal region : HRP
SKU
AVIARP54547_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: SOHLH1 contains 1 basic helix-loop-helix (bHLH) domain. It is a probable transcription factor required during spermatogenesis and oogenesis.

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human SOHLH1

Key Reference: Pangas,S.A., (2006) Proc. Natl. Acad. Sci. U.S.A. 103 (21), 8090-8095

Molecular Weight: 41kDa

Peptide Sequence: Synthetic peptide located within the following region: PAWAPAESSPLDVGEPGFLGDPELGSQELQDSPLEPWGLDVDCAGLALKD

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Spermatogenesis- and oogenesis-specific basic helix-loop-helix-containing protein 1

Protein Size: 387

Purification: Affinity Purified
More Information
SKU AVIARP54547_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP54547_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Yeast, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 402381
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×