SOX15 Antibody - N-terminal region : Biotin

SOX15 Antibody - N-terminal region : Biotin
SKU
AVIARP57899_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: SOX15 is a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of the cell fate. The protein may act as a transcriptional regulator after forming a protein complex with other proteins.This gene encodes a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of the cell fate. The encoded protein may act as a transcriptional regulator after forming a protein complex with other proteins.This gene encodes a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of the cell fate. The encoded protein may act as a transcriptional regulator after forming a protein complex with other proteins.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SOX15

Key Reference: Yan,H.T., (2007) Mol. Cells 24 (3), 323-328

Molecular Weight: 25kDa

Peptide Sequence: Synthetic peptide located within the following region: ALPGSSQDQAWSLEPPAATAAASSSSGPQEREGAGSPAAPGTLPLEKVKR

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Protein SOX-15

Protein Size: 233

Purification: Affinity Purified
More Information
SKU AVIARP57899_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57899_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Pig (Porcine), Dog (Canine), Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 6665
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×