SPA17 Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: This gene encodes a protein present at the cell surface. The N-terminus has sequence similarity to human cAMP-dependent protein kinase A (PKA) type II alpha regulatory subunit (RIIa) while the C-terminus has an IQ calmodulin-binding motif. The central portion of the protein has carbohydrate binding motifs and likely functions in cell-cell adhesion. The protein was initially characterized by its involvement in the binding of sperm to the zona pellucida of the oocyte. Recent studies indicate that it is also involved in additional cell-cell adhesion functions such as immune cell migration and metastasis. A retrotransposed pseudogene is present on chromosome 10q22.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SPA17

Molecular Weight: 17kDa

Peptide Sequence: Synthetic peptide located within the following region: MSIPFSNTHYRIPQGFGNLLEGLTREILREQPDNIPAFAAAYFESLLEKR

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Sperm surface protein Sp17

Protein Size: 151

Purification: Affinity Purified

• SKU: AVIARP53719_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP53719_P050-FITC
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 53340
• Host: Rabbit
• Conjugate: Conjugated, FITC