SPACA9 Antibody - C-terminal region : Biotin

Conjugation: Biotin

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse 1700026L06Rik

Molecular Weight: 18kDa

Peptide Sequence: Synthetic peptide located within the following region: VTNSLLEKCKTLVSQSNDLSSLRAKYPHEVVNHLSCDEARNHYGGVVSLI

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: sperm acrosome-associated protein 9

Protein Size: 168

Purification: Affinity Purified

• SKU: AVIARP53733_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP53733_P050-Biotin
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 69987
• Host: Rabbit
• Conjugate: Conjugated, Biotin