SPAG11B Antibody - N-terminal region : Biotin

Conjugation: Biotin

Description of Target: SPAG11B is one of several androgen-dependent, epididymis-specific secretory proteins. The specific functions of these proteins have not been determined, but they are thought to be involved in sperm maturation. Some of the isoforms contain regions of similarity to beta-defensins, a family of antimicrobial peptides.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human SPAG11B

Molecular Weight: 14kDa

Peptide Sequence: Synthetic peptide located within the following region: VALLFPGSSQARHVNHSATEALGELRERAPGQGTNGFQLLRHAVKRDLLP

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Sperm-associated antigen 11B

Protein Size: 133

Purification: Affinity Purified

• SKU: AVIARP53718_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP53718_P050-Biotin
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 10407
• Host: Rabbit
• Conjugate: Conjugated, Biotin