SPAG6 Antibody - middle region : Biotin

Conjugation: Biotin

Description of Target: SPAG6 is important for structural integrity of the central apparatus in the sperm tail and for flagellar motility.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SPAG6

Molecular Weight: 50kDa

Peptide Sequence: Synthetic peptide located within the following region: LQKCTYLPALEPFLYDAPPNILKHVVGQFSKVLFPWIFRYTSAEGGQLST

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Sperm-associated antigen 6

Protein Size: 458

Purification: Affinity Purified

• SKU: AVIARP53838_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP53838_P050-Biotin
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 9576
• Host: Rabbit
• Conjugate: Conjugated, Biotin