SPATA24 Antibody - C-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: SPATA24 binds DNA with high affinity but does not bind to TATA boxes.SPATA24 synergises with GMNN and TBP in activation of TATA box-containing promoters and with GMNN and TBPL1 in activation of the NF1 TATA-less promoter.SPATA24 may play a role in cytoplasm movement and removal during spermiogenesis.

Immunogen: The immunogen is a synthetic peptide directed towards the c terminal region of human SPATA24

Molecular Weight: 23kDa

Peptide Sequence: Synthetic peptide located within the following region: LQQVISQQKQIFRNHMSDFRIQKQQESYMAQVLDQKHKKASGTRQARSHQ

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Spermatogenesis-associated protein 24

Protein Size: 205

Purification: Affinity Purified

• SKU: AVIARP53546_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP53546_P050-HRP
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 202051
• Host: Rabbit
• Conjugate: Conjugated, HRP