SPDYA Antibody - middle region : Biotin

SPDYA Antibody - middle region : Biotin
SKU
AVIARP55846_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: SPDYA regulates the G1/S phase transition of the cell cycle by binding and activating CDC2, CDK2 and CDKN1B/KIP1. SPDYA can activate CDK2 without promoting CDK2 phosphorylation. SPDYA mediates cell survival during the DNA damage process through activation of CDK2.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SPDYA

Key Reference: McAndrew,C.W., (2007) Cell Cycle 6 (15), 1937-1945

Molecular Weight: 36kDa

Peptide Sequence: Synthetic peptide located within the following region: HTAGVTEKHSQDSYNSLSMDIIGDPSQAYTGSEVVNDHQSNKGKKTNFLK

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Speedy protein A

Protein Size: 313

Purification: Affinity Purified
More Information
SKU AVIARP55846_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55846_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human
Clonality Polyclonal
Application Western Blotting
Human Gene ID 245711
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×