SPDYE1 Antibody - C-terminal region : Biotin

SPDYE1 Antibody - C-terminal region : Biotin
SKU
AVIARP57845_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: This gene is located at chromosome 7p13 which is close to the Williams Beuren syndrome chromosome region 7q11.23.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human SPDYE1

Molecular Weight: 36kDa

Peptide Sequence: Synthetic peptide located within the following region: RCMNPRARKNRSQIVLFQKRRFHFFCSMSCRAWVSPEELEEIQAYDPEHW

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Speedy protein E1

Protein Size: 336

Purification: Affinity Purified
More Information
SKU AVIARP57845_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57845_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit
Clonality Polyclonal
Application Western Blotting
Human Gene ID 285955
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×