SPNS2 Antibody - N-terminal region : HRP

SPNS2 Antibody - N-terminal region : HRP
SKU
AVIARP56057_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: SPNS2 is the sphingolipid transporter required for migration of myocardial precursors. SPNS2 transports sphingosine 1-phosphate (S1P), a secreted lipid mediator that plays critical roles in cardiovascular, immunological, and neural development and function. SPNS2 mediates the export of S1P from cells in the extraembryonic yolk syncytial layer (YSL), thereby regulating myocardial precursor migration.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SPNS2

Molecular Weight: 60kDa

Peptide Sequence: Synthetic peptide located within the following region: PPGTPGTPGCAATAKGPGAQQPKPASLGRGRGAAAAILSLGNVLNYLDRY

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Protein spinster homolog 2

Protein Size: 549

Purification: Affinity Purified
More Information
SKU AVIARP56057_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56057_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit
Clonality Polyclonal
Application Western Blotting
Human Gene ID 124976
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×