SPO11 Antibody - N-terminal region : Biotin

SPO11 Antibody - N-terminal region : Biotin
SKU
AVIARP54901_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: Meiotic recombination and chromosome segregation require the formation of double-strand breaks (DSBs) in paired chromosome homologs. During meiosis in yeast, a meiotic recombination protein is covalently-linked to the 5' end of DSBs and is essential for the formation of DSBs. SPO11 is similar in sequence and conserved features to the yeast meiotic recombination protein. It belongs to the TOP6A protein family. Meiotic recombination and chromosome segregation require the formation of double-strand breaks (DSBs) in paired chromosome homologs. During meiosis in yeast, a meiotic recombination protein is covalently-linked to the 5' end of DSBs and is essential for the formation of DSBs. The protein encoded by this gene is similar in sequence and conserved features to the yeast meiotic recombination protein. The encoded protein belongs to the TOP6A protein family. Several transcript variants encoding different isoforms have been found for this gene, but the full-length nature of only two of them have been described.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SPO11

Key Reference: Lin,C.S., (2008) Eur. J. Endocrinol. 158 (1), 107-115

Molecular Weight: 44kDa

Peptide Sequence: Synthetic peptide located within the following region: KFSLILKILSMIYKLVQSNTYATKRDIYYTDSQLFGNQTVVDNIINDISC

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Meiotic recombination protein SPO11

Protein Size: 396

Purification: Affinity Purified
More Information
SKU AVIARP54901_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP54901_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 23626
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×