SRR Antibody - middle region : Biotin

SRR Antibody - middle region : Biotin
SKU
AVIARP57572_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: SRR catalyzes the synthesis of D-serine from L-serine.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SRR

Molecular Weight: 36kDa

Peptide Sequence: Synthetic peptide located within the following region: GVGVAAVLSQHFQTVSPEVKNICIVLSGGNVDLTSSITWVKQAERPASYQ

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Serine racemase

Protein Size: 340

Purification: Affinity Purified
More Information
SKU AVIARP57572_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57572_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 63826
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×