SSBP3 Antibody - middle region : HRP

SSBP3 Antibody - middle region : HRP
SKU
AVIARP55355_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: SSBP3 may be involved in transcription regulation of the alpha 2(I) collagen gene where it binds to the single-stranded polypyrimidine sequences in the promoter region.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SSBP3

Key Reference: Adams,M.D., (2006) Biochem. Biophys. Res. Commun. 339 (3), 977-984

Molecular Weight: 38kDa

Peptide Sequence: Synthetic peptide located within the following region: DIDGLPKNSPNNISGISNPPGTPRDDGELGGNFLHSFQNDNYSPSMTMSV

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Single-stranded DNA-binding protein 3

Protein Size: 368

Purification: Affinity Purified
More Information
SKU AVIARP55355_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55355_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 23648
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×