SSX1 Antibody - middle region : HRP

SSX1 Antibody - middle region : HRP
SKU
AVIARP57900_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The product of this gene belongs to the family of highly homologous synovial sarcoma X (SSX) breakpoint proteins. These proteins may function as transcriptional repressors. They are also capable of eliciting spontaneously humoral and cellular immune respo

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SSX1

Key Reference: Tornkvist,M., (2008) Biochem. Biophys. Res. Commun. 368 (3), 793-800

Molecular Weight: 22kDa

Peptide Sequence: Synthetic peptide located within the following region: MCNKQATDFQGNDFDNDHNRRIQVEHPQMTFGRLHRIIPKIMPKKPAEDE

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Protein SSX1

Protein Size: 188

Purification: Affinity Purified
More Information
SKU AVIARP57900_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57900_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human
Clonality Polyclonal
Application Western Blotting
Human Gene ID 6756
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×