St6galnac2 Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: The function of this protein remains unknown.

Molecular Weight: 41kDa

Peptide Sequence: Synthetic peptide located within the following region: SAILGVPVPEGPDKGDRPHIYFGPETSASKFKLLHPDFIGYLTERFLKSK

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Alpha-2,6-sialyltransferase ST6GalNAc II EMBL CAG25679.1

Protein Size: 373

Purification: Affinity Purified

• SKU: AVIARP53654_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP53654_P050-HRP
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 303692
• Host: Rabbit
• Conjugate: Conjugated, HRP