STAMBPL1 Antibody - N-terminal region : Biotin

STAMBPL1 Antibody - N-terminal region : Biotin
SKU
AVIARP57453_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: STAMBPL1 is a zinc metalloprotease that specifically cleaves 'Lys-63'-linked polyubiquitin chains.STAMBPL1 does not cleave 'Lys-48'-linked polyubiquitin chains.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human STAMBPL1

Molecular Weight: 50kDa

Peptide Sequence: Synthetic peptide located within the following region: MDQPFTVNSLKKLAAMPDHTDVSLSPEERVRALSKLGCNITISEDITPRR

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: AMSH-like protease

Protein Size: 436

Purification: Affinity Purified
More Information
SKU AVIARP57453_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57453_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 57559
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×