STIMATE Antibody - N-terminal region : Biotin

STIMATE Antibody - N-terminal region : Biotin
SKU
AVIARP55905_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human TMEM110

Key Reference: Gerhard,D.S., Genome Res. 14 (10B), 2121-2127 (2004)

Molecular Weight: 33kDa

Peptide Sequence: Synthetic peptide located within the following region: MQGPAGNASRGLPGGPPSTVASGAGRCESGALMHSFGIFLQGLLGVVAFS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: store-operated calcium entry regulator STIMATE

Protein Size: 294

Purification: Affinity Purified
More Information
SKU AVIARP55905_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55905_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Rat (Rattus), Rabbit
Clonality Polyclonal
Application Western Blotting
Human Gene ID 375346
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×