STK38L Antibody - middle region : Biotin

STK38L Antibody - middle region : Biotin
SKU
AVIARP55142_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: STK38L is involved in the regulation of structural processes in differentiating and mature neuronal cells.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human STK38L

Molecular Weight: 54kDa

Peptide Sequence: Synthetic peptide located within the following region: PAAIPIEIKSIDDTSNFDDFPESDILQPVPNTTEPDYKSKDWVFLNYTYK

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Serine/threonine-protein kinase 38-like

Protein Size: 464

Purification: Affinity Purified
More Information
SKU AVIARP55142_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55142_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 23012
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×