STK38L Antibody - middle region : HRP

STK38L Antibody - middle region : HRP
SKU
AVIARP55142_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: STK38L is involved in the regulation of structural processes in differentiating and mature neuronal cells.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human STK38L

Molecular Weight: 54kDa

Peptide Sequence: Synthetic peptide located within the following region: PAAIPIEIKSIDDTSNFDDFPESDILQPVPNTTEPDYKSKDWVFLNYTYK

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Serine/threonine-protein kinase 38-like

Protein Size: 464

Purification: Affinity Purified
More Information
SKU AVIARP55142_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55142_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 23012
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×