SUSD3 Antibody - N-terminal region : HRP

SUSD3 Antibody - N-terminal region : HRP
SKU
AVIARP55443_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The exact function of SUSD3 remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SUSD3

Key Reference: Humphray,S.J., (2004) Nature 429 (6990), 369-374

Molecular Weight: 27kDa

Peptide Sequence: Synthetic peptide located within the following region: LRLPPQATFQVLRGNGASVGTVLMFRCPSNHQMVGSGLLTCTWKGSIAEW

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Sushi domain-containing protein 3

Protein Size: 255

Purification: Affinity Purified
More Information
SKU AVIARP55443_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55443_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Pig (Porcine), Cow (Bovine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 203328
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×