SYCP1 Antibody - N-terminal region : FITC

SYCP1 Antibody - N-terminal region : FITC
SKU
AVIARP58330_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: SYCP1 is a major component of the transverse filaments of synaptonemal complexes (SCS), which is formed between homologous chromosomes during meiotic prophase.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SYCP1

Key Reference: Neumann,F., (2005) Blood 106 (9), 3105-3113

Molecular Weight: 107kDa

Peptide Sequence: Synthetic peptide located within the following region: NFLPVLEQVGNSDCHYQEGLKDSDLENSEGLSRVYSKLYKEAEKIKKWKV

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Synaptonemal complex protein 1

Protein Size: 976

Purification: Affinity Purified
More Information
SKU AVIARP58330_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP58330_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting, Immunohistochemistry
Human Gene ID 6847
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×