SYCP3 Antibody - N-terminal region : HRP

SYCP3 Antibody - N-terminal region : HRP
SKU
AVIARP58334_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: SYCP3 is a component of the transverse filaments of synaptonemal complexes (SCS), formed between homologous chromosomes during meiotic prophase. It has an essential meiotic function in spermatogenesis. SYCP3 may be important for testis development.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SYCP3

Key Reference: Bukovsky,A., (2008) Cell Cycle 7 (5), 683-686

Molecular Weight: 26kDa

Peptide Sequence: Synthetic peptide located within the following region: VSSGKKYSRKSGKPSVEDQFTRAYDFETEDKKDLSGSEEDVIEGKTAVIE

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Synaptonemal complex protein 3

Protein Size: 236

Purification: Affinity Purified
More Information
SKU AVIARP58334_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP58334_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human
Clonality Polyclonal
Application Western Blotting, Immunohistochemistry
Human Gene ID 50511
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×