SYCP3 Antibody - N-terminal region : HRP

SYCP3 Antibody - N-terminal region : HRP
SKU
AVIARP58335_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: This gene encodes an essential structural component of the synaptonemal complex. This complex is involved in synapsis, recombination and segregation of meiotic chromosomes. Mutations in this gene are associated with azoospermia in males and susceptibility to pregnancy loss in females. Alternate splicing results in multiple transcript variants that encode the same protein.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human SYCP3

Molecular Weight: 25kDa

Peptide Sequence: Synthetic peptide located within the following region: KYSRKSGKPSVEDQFTRAYDFETEDKKDLSGSEEDVIEGKTAVIEKRRKK

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Synaptonemal complex protein 3

Protein Size: 236

Purification: Affinity Purified
More Information
SKU AVIARP58335_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP58335_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 50511
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×