TAF7L Antibody - middle region : Biotin

Conjugation: Biotin

Description of Target: TAF7L gene is similar to a mouse gene that encodes a TATA box binding protein-associated factor, and shows testis-specific expression.This gene is similar to a mouse gene that encodes a TATA box binding protein-associated factor, and shows testis-specific expression.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TAF7L

Key Reference: Akinloye,O., (2007) Andrologia 39 (5), 190-195

Molecular Weight: 51kDa

Peptide Sequence: Synthetic peptide located within the following region: QKQIEKKEKKLHKIQNKAQRQKDLIMKVENLTLKNHFQSVLEQLELQEKQ

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Transcription initiation factor TFIID subunit 7-like

Protein Size: 462

Purification: Affinity Purified

Subunit: 7-like

• SKU: AVIARP53778_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP53778_P050-Biotin
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Dog (Canine), Cow (Bovine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 54457
• Host: Rabbit
• Conjugate: Conjugated, Biotin