TAF7L Antibody - middle region : HRP

TAF7L Antibody - middle region : HRP
SKU
AVIARP53778_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: TAF7L gene is similar to a mouse gene that encodes a TATA box binding protein-associated factor, and shows testis-specific expression.This gene is similar to a mouse gene that encodes a TATA box binding protein-associated factor, and shows testis-specific expression.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TAF7L

Key Reference: Akinloye,O., (2007) Andrologia 39 (5), 190-195

Molecular Weight: 51kDa

Peptide Sequence: Synthetic peptide located within the following region: QKQIEKKEKKLHKIQNKAQRQKDLIMKVENLTLKNHFQSVLEQLELQEKQ

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Transcription initiation factor TFIID subunit 7-like

Protein Size: 462

Purification: Affinity Purified

Subunit: 7-like
More Information
SKU AVIARP53778_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP53778_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Dog (Canine), Cow (Bovine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 54457
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×