TASP1 Antibody - middle region : HRP

TASP1 Antibody - middle region : HRP
SKU
AVIARP57018_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: This gene encodes an endopeptidase that cleaves specific substrates following aspartate residues. The encoded protein undergoes posttranslational autoproteolytic processing to generate alpha and beta subunits, which reassemble into the active alpha2-beta2

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TASP1

Molecular Weight: 19kDa

Peptide Sequence: Synthetic peptide located within the following region: QNKQTLLVEFLWSHTTESMCVGYMSAQDGKAKTHISRLPPGAVAGQSVAI

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Threonine aspartase 1

Protein Size: 420

Purification: Affinity Purified
More Information
SKU AVIARP57018_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57018_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 55617
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×