TBC1D10C Antibody - N-terminal region : HRP

TBC1D10C Antibody - N-terminal region : HRP
SKU
AVIARP55893_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: TBC1D10C inhibits the Ras signaling pathway through its intrinsic Ras GTPase-activating protein (GAP) activity. TBC1D10C acts as a negative feedback inhibitor of the calcineurin signaling pathway that also mediates crosstalk between calcineurin and Ras.Carabin is an endogenous inhibitor of calcineurin (see MIM 114105) that also inhibits the Ras (see MIM 190020) signaling pathway through its intrinsic Ras GTPase-activating protein activity (Pan et al., 2007 [PubMed 17230191]).[supplied by OMIM].

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human TBC1D10C

Key Reference: Pan,F., (2007) Nature 445 (7126), 433-436

Molecular Weight: 50kDa

Peptide Sequence: Synthetic peptide located within the following region: MAQALGEDLVQPPELQDDSSSLGSDSELSGPGPYRQADRYGFIGGSSAEP

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Carabin

Protein Size: 446

Purification: Affinity Purified
More Information
SKU AVIARP55893_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55893_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Rat (Rattus), Pig (Porcine), Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 374403
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×