TBC1D19 Antibody - middle region : HRP

TBC1D19 Antibody - middle region : HRP
SKU
AVIARP57195_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: TBC1D19 may act as a GTPase-activating protein for Rab family protein(s).

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TBC1D19

Molecular Weight: 60kDa

Peptide Sequence: Synthetic peptide located within the following region: PVYAPKDFLEVLINLRNPNYENGDSLSFRTHLGLIQVPLKVKDIPELKEC

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: TBC1 domain family member 19

Protein Size: 526

Purification: Affinity Purified
More Information
SKU AVIARP57195_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57195_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 55296
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×