TBC1D25 Antibody - C-terminal region : Biotin

TBC1D25 Antibody - C-terminal region : Biotin
SKU
AVIARP56370_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: This gene encodes a protein with a TBC domain and may function as a Rab GTPase activating protein. This gene was previously known as ornithine aminotransferase-like 1, but has no similarity to ornithine aminotransferase.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of HUMAN TBC1D25

Molecular Weight: 75kDa

Peptide Sequence: Synthetic peptide located within the following region: STFEDAVDHLATASQGPGGGGRLLRQASLDGLQQLRDNMGSRRDPLVQLP

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: TBC1 domain family member 25

Protein Size: 688

Purification: Affinity Purified
More Information
SKU AVIARP56370_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56370_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 4943
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×