TBC1D25 Antibody - N-terminal region : FITC

TBC1D25 Antibody - N-terminal region : FITC
SKU
AVIARP56369_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: This gene encodes a protein with a TBC domain and may function as a Rab GTPase activating protein. This gene was previously known as ornithine aminotransferase-like 1, but has no similarity to ornithine aminotransferase.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human TBC1D25

Key Reference: Aizawa,T., (2003) Biochim. Biophys. Acta 1603 (2), 47-82

Molecular Weight: 76kDa

Peptide Sequence: Synthetic peptide located within the following region: KVQQVLSWSYGEDVKPFKPPLSDAEFHTYLNHEGQLSRPEELRLRIYHGG

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: TBC1 domain family member 25

Protein Size: 688

Purification: Affinity Purified
More Information
SKU AVIARP56369_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56369_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 4943
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×