TBK1 Antibody - middle region : Biotin

TBK1 Antibody - middle region : Biotin
SKU
AVIARP54922_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: The NF-kappa-B (NFKB) complex of proteins is inhibited by I-kappa-B (IKB) proteins, which inactivate NFKB by trapping it in the cytoplasm. Phosphorylation of serine residues on the IKB proteins by IKB kinases marks them for destruction via the ubiquitinat

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TBK1

Key Reference: Morton,S., (2008) FEBS Lett. 582 (6), 997-1002

Molecular Weight: 84kDa

Peptide Sequence: Synthetic peptide located within the following region: QEGTHPKDRNVEKLQVLLNCMTEIYYQFKKDKAERRLAYNEEQIHKFDKQ

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Serine/threonine-protein kinase TBK1

Protein Size: 729

Purification: Affinity Purified
More Information
SKU AVIARP54922_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP54922_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 29110
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×