TBL2 Antibody - N-terminal region : Biotin

TBL2 Antibody - N-terminal region : Biotin
SKU
AVIARP53685_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: TBL2 is a member of the beta-transducin protein family. Most proteins of the beta-transducin family are involved in regulatory functions. This protein is possibly involved in some intracellular signaling pathway. This gene is deleted in Williams-Beuren syndrome, a developmental disorder caused by deletion of multiple genes at 7q11.23. This gene encodes a member of the beta-transducin protein family. Most proteins of the beta-transducin family are involved in regulatory functions. This protein is possibly involved in some intracellular signaling pathway. This gene is deleted in Williams-Beuren syndrome, a developmental disorder caused by deletion of multiple genes at 7q11.23.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human TBL2

Key Reference: Kathiresan,S., (2008) Nat. Genet. 40 (2), 189-197

Molecular Weight: 49kDa

Peptide Sequence: Synthetic peptide located within the following region: RSGRPACQKANGFPPDKSSGSKKQKQYQRIRKEKPQQHNFTHRLLAAALK

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Transducin beta-like protein 2

Protein Size: 447

Purification: Affinity Purified
More Information
SKU AVIARP53685_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP53685_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rabbit, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 26608
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×