TCP11L2 Antibody - N-terminal region : FITC

TCP11L2 Antibody - N-terminal region : FITC
SKU
AVIARP55541_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The specific function of TCP11L2 is not yet known.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human TCP11L2

Key Reference: Strausberg,R.L., (2002) Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903

Molecular Weight: 58kDa

Peptide Sequence: Synthetic peptide located within the following region: VHQAFWDVLDSELNADPPEFEHAIKLFEEIREILLSFLTPGGNRLRNQIC

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: T-complex protein 11-like protein 2

Protein Size: 519

Purification: Affinity Purified
More Information
SKU AVIARP55541_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55541_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 255394
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×