TCP11L2 Antibody - N-terminal region : HRP

TCP11L2 Antibody - N-terminal region : HRP
SKU
AVIARP55541_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The specific function of TCP11L2 is not yet known.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human TCP11L2

Key Reference: Strausberg,R.L., (2002) Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903

Molecular Weight: 58kDa

Peptide Sequence: Synthetic peptide located within the following region: VHQAFWDVLDSELNADPPEFEHAIKLFEEIREILLSFLTPGGNRLRNQIC

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: T-complex protein 11-like protein 2

Protein Size: 519

Purification: Affinity Purified
More Information
SKU AVIARP55541_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55541_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 255394
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×