TCTE1 Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: TCTE1 contains 7 LRR (leucine-rich) repeats. The exact function of TCTE1 remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TCTE1

Key Reference: Watanabe,T.K., Cytogenet. Cell Genet. 73 (1-2), 153-156 (1996)

Molecular Weight: 56kDa

Peptide Sequence: Synthetic peptide located within the following region: MNFEWNLFLFTYRDCLSLAAAIKACHTLKIFKLTRSKVDDDKARIIIRSL

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: T-complex-associated testis-expressed protein 1

Protein Size: 501

Purification: Affinity Purified

• SKU: AVIARP53433_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP53433_P050-HRP
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 202500
• Host: Rabbit
• Conjugate: Conjugated, HRP