Tdrd7 Antibody - C-terminal region : Biotin

Tdrd7 Antibody - C-terminal region : Biotin
SKU
AVIARP55002_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: Tdrd7 binds to PCTAIRE 2, a Cdc2-related kinase expressed in the terminally differentiated neuron; contains five tudor-like domains; may mediate the regulation of mitochondrial function in the neurons.

Molecular Weight: 122kDa

Peptide Sequence: Synthetic peptide located within the following region: CSDCSIKVTKVDEARGVAYVYLFTPKNFPDPHRSINRQITNADLWKHQKD

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Tudor domain-containing protein 7

Protein Size: 1113

Purification: Affinity Purified
More Information
SKU AVIARP55002_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55002_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 85425
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×