TEDC1 Antibody - N-terminal region : Biotin

TEDC1 Antibody - N-terminal region : Biotin
SKU
AVIARP55661_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Immunogen: The immunogen is a synthetic peptide directed towards the n terminal region of human C14orf80

Molecular Weight: 28kDa

Peptide Sequence: Synthetic peptide located within the following region: MLAQARVPLGDEMTVCQIHLYTRGCHSDQSLSHLSVTEAEMLRDPEGGQQ

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: tubulin epsilon and delta complex protein 1

Protein Size: 248

Purification: Affinity Purified
More Information
SKU AVIARP55661_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55661_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Rat (Rattus), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 283643
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×