TESMIN Antibody - N-terminal region : HRP

TESMIN Antibody - N-terminal region : HRP
SKU
AVIARP53623_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: Metallothionein proteins are highly conserved low-molecular-weight cysteine-rich proteins that are induced by and bind to heavy metal ions and have no enzymatic activity. They may play a central role in the regulation of cell growth and differentiation and are involved in spermatogenesis. This gene encodes a metallothionein-like protein which has been shown to be expressed differentially in mouse testis and ovary. Two transcript variants encoding different isoforms have been found for this gene.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human MTL5

Key Reference: Oh,J.H., (2005) Mamm. Genome 16 (12), 942-954

Molecular Weight: 56kDa

Peptide Sequence: Synthetic peptide located within the following region: EAYLGPADPKEPVLHAFNPALGADCKGQVKAKLAGGDSDGGELLGEYPGI

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: tesmin

Protein Size: 508

Purification: Affinity Purified
More Information
SKU AVIARP53623_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP53623_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Dog (Canine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 9633
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×