TEX11 Antibody - C-terminal region : FITC

TEX11 Antibody - C-terminal region : FITC
SKU
AVIARP56160_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: This gene is X-linked and is expressed in only male germ cells. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human TEX11

Molecular Weight: 67kDa

Peptide Sequence: Synthetic peptide located within the following region: SLAAQFALENGQQIVAEKALEYLAQHSEDQEQVLTAVKCLLRFLLPKIAE

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Testis-expressed sequence 11 protein

Protein Size: 615

Purification: Affinity Purified
More Information
SKU AVIARP56160_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56160_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Pig (Porcine), Dog (Canine), Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 56159
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×