TEX14 Antibody - C-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: TEX14 belongs to the protein kinase superfamily. It contains 3 ANK repeats and 1 protein kinase domain. TEX14 is required for spermatogenesis and male fertility. It may be required for normal structure of the intercellular bridge that connects spermatocytes and spermatogonia. It has no protein kinase activity. This gene is similar to a mouse gene that is expressed in the testis.

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human TEX14

Key Reference: Wu,M.H., (2003) Gene Expr. Patterns 3 (2), 231-236

Molecular Weight: 160kDa

Peptide Sequence: Synthetic peptide located within the following region: ASSDTLVAVEKSYSTSSPIEEDFEGIQGAFAQPQVSGEEKFQMRKILGKN

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Inactive serine/threonine-protein kinase TEX14

Protein Size: 1451

Purification: Affinity Purified

• SKU: AVIARP53844_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP53844_P050-HRP
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Rat (Rattus), Rabbit, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 56155
• Host: Rabbit
• Conjugate: Conjugated, HRP