TEX14 Antibody - middle region : Biotin

TEX14 Antibody - middle region : Biotin
SKU
AVIARP53843_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: TEX14 belongs to the protein kinase superfamily. It contains 3 ANK repeats and 1 protein kinase domain. TEX14 is required for spermatogenesis and male fertility. It may be required for normal structure of the intercellular bridge that connects spermatocytes and spermatogonia. It has no protein kinase activity.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TEX14

Molecular Weight: 164kDa

Peptide Sequence: Synthetic peptide located within the following region: TPDGEYFYSSTAQENLALETSSPIEEDFEGIQGAFAQPQVSGEEKFQMRK

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Inactive serine/threonine-protein kinase TEX14

Protein Size: 1491

Purification: Affinity Purified
More Information
SKU AVIARP53843_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP53843_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 56155
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×