TEX45 Antibody - middle region : Biotin

TEX45 Antibody - middle region : Biotin
SKU
AVIARP55899_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human C19orf45

Molecular Weight: 56kDa

Peptide Sequence: Synthetic peptide located within the following region: QALPGPPALRCKRASSGVELGDCKISYGSTCSEQKQAYRPQDLPEDRYDK

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: testis-expressed protein 45

Protein Size: 491

Purification: Affinity Purified
More Information
SKU AVIARP55899_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55899_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Pig (Porcine), Dog (Canine), Cow (Bovine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 374877
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×