TFDP3 Antibody - N-terminal region : HRP

TFDP3 Antibody - N-terminal region : HRP
SKU
AVIARP58170_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The specific function of the protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human TFDP3

Molecular Weight: 38kDa

Peptide Sequence: Synthetic peptide located within the following region: PVVGSPNPPSTHFASQNQHSYSSPPWAGQHNRKGEKNGMGLCRLSMKVWE

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Transcription factor Dp family member 3

Protein Size: 345

Purification: Affinity Purified
More Information
SKU AVIARP58170_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP58170_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Rat (Rattus), Rabbit, Guinea Pig
Clonality Polyclonal
Application Western Blotting
Human Gene ID 51270
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×