TFEB Antibody - middle region : HRP

TFEB Antibody - middle region : HRP
SKU
AVIARP58116_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The TFEB gene fuses with an intronless gene in renal tumors harboring the t(6;11)(p21;q13) chromosome translocation. It encodes a protein that is a highly sensitive and specific diagnostic marker for renal neoplasms.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TFEB

Molecular Weight: 53kDa

Peptide Sequence: Synthetic peptide located within the following region: DFSHSLSFGGREDEGPPGYPEPLAPGHGSPFPSLSKKDLDLMLLDDSLLP

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Transcription factor EB

Protein Size: 476

Purification: Affinity Purified
More Information
SKU AVIARP58116_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP58116_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Rabbit, Dog (Canine), Cow (Bovine), Goat (Caprine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 7942
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×